>1f3h_B mol:protein length:142  SURVIVIN
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDMAQCFF
CFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETN
NKKKEFEETAKKVRRAIEQLAAMD
>1f3h_B mol:protein length:142  SURVIVIN
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDMAQCFF
CFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETN
NKKKEFEETAKKVRRAIEQLAAMD
>1f3h_A mol:protein length:142  SURVIVIN
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDMAQCFF
CFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETN
NKKKEFEETAKKVRRAIEQLAAMD