>1f6a_D mol:protein length:222  IG EPSILON CHAIN C REGION
ADPCDSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNH
STRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAP
EVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSG
FFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK