>1f9e_E mol:protein length:153  CASPASE-8 ALPHA CHAIN
LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFE
IKPHHDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQ
FTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD