>1f9e_J mol:protein length:89  CASPASE-8 BETA CHAIN
TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNY
EVSNKDDKKNMGKQMPQPTFTLRKKLVFPS