>1fns_A mol:protein length:196  VON WILLEBRAND FACTOR
MYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRVSQKWVRVAVVEYHDGSHAY
IGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMAS
QEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDEL
EQQRDEIVSYLCDLAPEAP