>1fns_H mol:protein length:225  IMMUNOGLOBULIN NMC-4 IGG1
QVQLKESGPGLVAPSQSLSITCTVSGFSLTDYGVDWVRQPPGKGLEWLGMIWGDGSTDY
NSALKSRLSITKDNSKSQVFLKMNSLQTDDTARYYCVRDPADYGNYDYALDYWGQGTSV
TVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPA
VLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG