>1fns_L mol:protein length:214  IMMUNOGLOBULIN NMC-4 IGG1
DIQMTQSPSSLSASLGDRVTISCSASQDINKYLNWYQQKPDGAVKLLIFYTSSLHSGVP
SRFSGSGSGTDYSLTISNLEPEDIATYYCQQYEKLPWTFGGGTKLEVKRADAAPTVSIF
PPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSS
TLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC