>1fsk_H mol:protein length:214  IMMUNOGLOBULIN KAPPA LIGHT CHAIN
NIVLTQSPKSMSVSVGERVTLSCKASENVDTYVFWFQQKPDQSPKLLLYGPSNRYTGVP
DRFTGSGSTTDFTLTISSVQAEDLADYHCGQSYSYPYTFGGGTKLEIKRADAAPTVSIF
PPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSS
TLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC