>1fsk_J mol:protein length:159  MAJOR POLLEN ALLERGEN BET V 1-A
GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFP
EGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISN
KYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN