>1fsk_L mol:protein length:220  ANTIBODY HEAVY CHAIN FAB
QVQLQQPGTELVRPGASVILSCKASGYTFTSYWINWVKQRPGQGLEWVGNIFPSDSYTN
YNQKFKDKATLTVDKSSSTAYMQVNSPTSEDSAVYYCTRGARDTWFAYWGQGTLVTVSV
AKTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC