>1fsx_C mol:protein length:141  HEMOGLOBIN ALPHA CHAIN
VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
AKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFT
PAVHASLDKFLANVSTVLTSKYR