>1g3i_L mol:protein length:174  ATP-DEPENDENT PROTEASE HSLV
TTIVSVRRNGQVVVGGDGQVSLGNTVMKGNARKVRRLYNGKVLAGFAGGTADAFTLFEL
FERKLEMHQGHLLKSAVELAKDWRTDRALRKLEAMLIVADEKESLIITGIGDVVQPEED
QILAIGSGGNYALSAARALVENTELSAHEIVEKSLRIAGDICVFTNTNFTIEELPN