>1g7b_B mol:protein length:30  INSULIN B-CHAIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT