>1g7b_D mol:protein length:30  INSULIN B-CHAIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT