>1g7b_H mol:protein length:30  INSULIN B-CHAIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT