>1g9n_L mol:protein length:214  ANTIBODY 17B, LIGHT CHAIN
ELELTQSPATLSVSPGERATLSCRASESVSSDLAWYQQKPGQAPRLLIYGASTRATGVP
ARFSGSGSGAEFTLTISSLQSEDFAVYYCQQYNNWPPRYTFGQGTRLEIKRTVAAPSVF
IFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQKSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG