>1gec_E mol:protein length:216  GLYCYL ENDOPEPTIDASE
LPESVDWRAKGAVTPVKHQGYCESCWAFSTVATVEGINKIKTGNLVELSEQELVDCDLQ
SYGCNRGYQSTSLQYVAQNGIHLRAKYPYIAKQQTCRANQVGGPKVKTNGVGRVQSNNE
GSLLNAIAHQPVSVVVESAGRDFQNYKGGIFEGSCGTKVDHAVTAVGYGKSGGKGYILI
KNSWGPGWGENGYIRIRRASGNSPGVCGVYRSSYYPIKN