>1gk4_F mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI
>1gk4_E mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI
>1gk4_A mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI
>1gk4_C mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI
>1gk4_D mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI
>1gk4_F mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI
>1gk4_B mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI