>1gk4_D mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI