>1gk4_F mol:protein length:84  VIMENTIN
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDL
LNVKMALDIEIATYRKLLEGEESRI