>1gk6_B mol:protein length:59  VIMENTIN
RMKQLEDKVEELLSKNYHLENEVARLKKLVGDLLNVKMALDIEIATYRKLLEGEESRIS