>1gn6_C mol:protein length:207  SUPEROXIDE DISMUTASE
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAI
LLNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAAT
TVQGSGWAALGWDTLGNKLLIFQVYDHQTNFPLAIVPLLLLDMWEHAFYLQYKNVKVDF
AKAFWNVVNWADVQSRYAAATSQTKGLIFG