>1gux_A mol:protein length:218  RETINOBLASTOMA PROTEIN
HTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKF
AKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLAC
ALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIK
HLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESA