>1gux_B mol:protein length:152  RETINOBLASTOMA PROTEIN
FQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYEL
MRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSII
VFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR