>1gzy_B mol:protein length:70  INSULIN-LIKE GROWTH FACTOR I
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEM
YCAPLKPAKSA
>1gzy_B mol:protein length:70  INSULIN-LIKE GROWTH FACTOR I
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEM
YCAPLKPAKSA