>1h2i_P mol:protein length:209  DNA REPAIR PROTEIN RAD52 HOMOLOG
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGG
GQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDG
SYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNK
LPRQLPLEVDLTKAKRQDLEPSVEEARYNSCR