>1h3z_A mol:protein length:109  HYPOTHETICAL 62.8 KDA PROTEIN C215.07C
GSERVNYKPGMRVLTKMSGFPWWPSMVVTESKMTSVARKSKPKRAGTFYPVIFFPNKEY
LWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTPDLDSLSVPS
>1h3z_A mol:protein length:109  HYPOTHETICAL 62.8 KDA PROTEIN C215.07C
GSERVNYKPGMRVLTKMSGFPWWPSMVVTESKMTSVARKSKPKRAGTFYPVIFFPNKEY
LWTGSDSLTPLTSEAISQFLEKPKPKTASLIKAYKMAQSTPDLDSLSVPS