>1h4l_E mol:protein length:147  CYCLIN-DEPENDENT KINASE 5 ACTIVATOR
STSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLY
MLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSV
INLMSSKMLQINADPHYFTQVFSDLKNES