>1h88_A mol:protein length:78  CCAAT/ENHANCER BINDING PROTEIN BETA
VKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKV
EQLSRELSTLRNLFKQLPE