>1hcs_B mol:protein length:107  HUMAN SRC
MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLN
VKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
>1hcs_A mol:protein length:6  ACETYL-PYEEIE-OH
XYEEIE
>1hcs_A mol:protein length:6  ACETYL-PYEEIE-OH
XYEEIE