>1he9_A mol:protein length:134  EXOENZYME S
KQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQ
VEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVAL
LRQAVESEVSRVSADY
>1he9_A mol:protein length:134  EXOENZYME S
KQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTALAGIRAGSQ
VEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQVMSEVAL
LRQAVESEVSRVSADY