>1hh0_A mol:protein length:46  PH75 INOVIRUS MAJOR COAT PROTEIN
MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG