>1hib_A mol:protein length:153  INTERLEUKIN-1 BETA
APVRSLNCGLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVA
LGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFP
NWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS