>1hls_A mol:protein length:21  INSULIN
GIVEQCCTSICSLYQLENYCN
>1hls_B mol:protein length:30  INSULIN
FVNQHLCGSHLVEALHLVCGERGFFYTPKT
>1hls_B mol:protein length:30  INSULIN
FVNQHLCGSHLVEALHLVCGERGFFYTPKT