>1hma_A mol:protein length:73  HMG-D
SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAK
DDYDRAVKEFEANG
>1hma_A mol:protein length:73  HMG-D
SDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAK
DDYDRAVKEFEANG