>1hnw_J mol:protein length:105  30S RIBOSOMAL PROTEIN S10
MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDS
REHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR