>1hun_B mol:protein length:69  HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWV
QEYVYDLELN