>1hyh_D mol:protein length:309  L-2-HYDROXYISOCAPROATE DEHYDROGENASE
ARKIGIIGLGNVGAAVAHGLIAQGVADDYVFIDANEAKVKADQIDFQDAMANLEAHGNI
VINDWAALADADVVISTLGNIKLQQDNPTGDRFAELKFTSSMVQSVGTNLKESGFHGVL
VVISNPVDVITALFQHVTGFPAHKVIGTGTLLDTARMQRAVGEAFDLDPRSVSGYNLGE
HGNSQFVAWSTVRVMGQPIVTLADAGDIDLAAIEEEARKGGFTVLNGKGYTSYGVATSA
IRIAKAVMADAHAELVVSNRRDDMGMYLSYPAIIGRDGVLAETTLDLTTDEQEKLLQSR
DYIQQRFDEIVDTL