>1i5z_A mol:protein length:209  CATABOLITE GENE ACTIVATOR PROTEIN
VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSA
QMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVG
CSRETVGRILKMLEDQNLISAHGKTIVVYGTR