>1i97_L mol:protein length:131  30S RIBOSOMAL PROTEIN S12
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSG
YEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGT
KKPKEAAKTAAKK