>1i97_O mol:protein length:88  30S RIBOSOMAL PROTEIN S15
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMV
GQRRRLLRYLQREDPERYRALIEKLGIRG