>1i97_P mol:protein length:88  30S RIBOSOMAL PROTEIN S16
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYW
LSVGAQPTDTARRLLRQAGVFRQEAREGA