>1i97_R mol:protein length:87  30S RIBOSOMAL PROTEIN S18
STKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSG
KEQRILAKTIKRARILGLLPFTEKLVRK