>1icn_A mol:protein length:131  INTESTINAL FATTY ACID BINDING PROTEIN
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNID
VVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVQEISGNELIQTYT
YEGVEAKRIFKKE
>1icn_A mol:protein length:131  INTESTINAL FATTY ACID BINDING PROTEIN
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNID
VVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVQEISGNELIQTYT
YEGVEAKRIFKKE