>1ifc_A mol:protein length:132  INTESTINAL FATTY ACID BINDING PROTEIN
MAFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNI
DVVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTY
TYEGVEAKRIFKKE