>1ii4_C mol:protein length:155  HEPARIN-BINDING GROWTH FACTOR 2
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH
IKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSR
KYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
>1ii4_E mol:protein length:220  FIBROBLAST GROWTH FACTOR RECEPTOR 2
NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIG
GYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPA
NASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKE
IEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE
>1ii4_D mol:protein length:155  HEPARIN-BINDING GROWTH FACTOR 2
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH
IKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSR
KYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
>1ii4_A mol:protein length:155  HEPARIN-BINDING GROWTH FACTOR 2
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH
IKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSR
KYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
>1ii4_G mol:protein length:220  FIBROBLAST GROWTH FACTOR RECEPTOR 2
NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIG
GYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPA
NASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKE
IEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE
>1ii4_F mol:protein length:220  FIBROBLAST GROWTH FACTOR RECEPTOR 2
NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIG
GYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPA
NASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKE
IEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE
>1ii4_H mol:protein length:220  FIBROBLAST GROWTH FACTOR RECEPTOR 2
NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIG
GYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPA
NASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKE
IEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE
>1ii4_B mol:protein length:155  HEPARIN-BINDING GROWTH FACTOR 2
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH
IKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSR
KYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
>1ii4_H mol:protein length:220  FIBROBLAST GROWTH FACTOR RECEPTOR 2
NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIG
GYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPA
NASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKE
IEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE