>1ii4_A mol:protein length:155  HEPARIN-BINDING GROWTH FACTOR 2
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH
IKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSR
KYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS