>1ii4_C mol:protein length:155  HEPARIN-BINDING GROWTH FACTOR 2
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH
IKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSR
KYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS