>1ii4_G mol:protein length:220  FIBROBLAST GROWTH FACTOR RECEPTOR 2
NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIG
GYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPA
NASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKE
IEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE