>1ij3_A mol:protein length:34  general control protein GCN4
XRMKQLEDKVEELLSKSYHLENEVARLKKLVGER